Recombinant Human Macrophage Migration Inhibitory Factor (Human MIF)_C230435

Description

Migration Inhibitory Factor (MIF) is a secreted protein without a cleavable signal sequence and is secreted via a specialized, non-classical pathway. It is secreted by macrophages upon stimulation by bacterial lipopolysaccharide (LPS), or by M.tuberculosis antigens. MIF consists of two α-helices and six β-strands, four of which form a β-sheet. The two remaining β-strands interact with other MIF molecules, creating a trimer. Structure-function studies suggest MIF is bifunctional with segregated topology. The N- and C-termini mediate enzyme activity (in theory). Phenylpyruvate tautomerase activity (enol-to-keto) has been demonstrated and is dependent upon Pro at position 1. Amino acids 50-65(a.a.) have also been suggested to contain thiol-protein oxidoreductase activity. MIF has proinflammatory cytokine activity centered around (a.a.) 49 - 65. On fibroblasts, MIF induces, IL-1, IL-8 and MMP expression; on macrophages, MIF stimulates NO production and TNF-α release folllowing IFN-γ activation. MIF apparently acts through CD74 and CD44, likely in some form of trimeric interaction. Human MIF is active on mouse cells. Human MIF is 90 %, 94 %, 95 %, and 90 % aa identical to mouse, bovine, porcine and rat MIF, respectively.

Product Properties

Synonyms
GIF Protein, Human; GLIF Protein, Human; MMIF Protein, Human
Accession
P14174
GeneID
4282
Source
E.coli-derived Human Macrophage Migration Inhibitory Factor protein, Met-Ala115
Molecular Weight
Approximately 12.5 kDa.
AA Sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSI
GKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Tag
None
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
> 97 % by SDS-PAGE and HPLC analyses.
Biological Activity
Fully biologically active when compared to standard. The specific activity is determined by binding rhCD74 in a functional ELISA.
Endotoxin
< 1.0 EU per 1μg of the protein by the LAL method.
Formulation
Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. Further dilutions should be made in appropriate buffered solutions.

 

Shipping and Storage

The products are shipped with ice pack and can be stored at -20℃ to -80℃ for 1 year.
Recommend to aliquot the protein into smaller quantities when first used and avoid repeated freeze-thaw cycles.

 

Cautions

1. Avoid repeated freeze-thaw cycles.
2. For your safety and health, please wear lab coats and disposable gloves for operation.
3. For research use only.

Recombinant Human Macrophage Migration Inhibitory Factor (Human MIF)_C230435

Product form

SKU: C230435E

$74.00

      • Tell a unique detail about this product

      Description

      Migration Inhibitory Factor (MIF) is a secreted protein without a cleavable signal sequence and is secreted via a specialized, non-classical pathway. It is secreted by macrophages upon stimulation by bacterial lipopolysaccharide (LPS), or by M.tuberculosis antigens. MIF consists of two α-helices and six β-strands, four of which form a β-sheet. The two remaining β-strands interact with other MIF molecules, creating a trimer. Structure-function studies suggest MIF is bifunctional with segregated topology. The N- and C-termini mediate enzyme activity (in theory). Phenylpyruvate tautomerase activity (enol-to-keto) has been demonstrated and is dependent upon Pro at position 1. Amino acids 50-65(a.a.) have also been suggested to contain thiol-protein oxidoreductase activity. MIF has proinflammatory cytokine activity centered around (a.a.) 49 - 65. On fibroblasts, MIF induces, IL-1, IL-8 and MMP expression; on macrophages, MIF stimulates NO production and TNF-α release folllowing IFN-γ activation. MIF apparently acts through CD74 and CD44, likely in some form of trimeric interaction. Human MIF is active on mouse cells. Human MIF is 90 %, 94 %, 95 %, and 90 % aa identical to mouse, bovine, porcine and rat MIF, respectively.

      Product Properties

      Synonyms
      GIF Protein, Human; GLIF Protein, Human; MMIF Protein, Human
      Accession
      P14174
      GeneID
      4282
      Source
      E.coli-derived Human Macrophage Migration Inhibitory Factor protein, Met-Ala115
      Molecular Weight
      Approximately 12.5 kDa.
      AA Sequence
      MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSI
      GKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
      Tag
      None
      Physical Appearance
      Sterile Filtered White lyophilized (freeze-dried) powder.
      Purity
      > 97 % by SDS-PAGE and HPLC analyses.
      Biological Activity
      Fully biologically active when compared to standard. The specific activity is determined by binding rhCD74 in a functional ELISA.
      Endotoxin
      < 1.0 EU per 1μg of the protein by the LAL method.
      Formulation
      Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
      Reconstitution
      We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. Further dilutions should be made in appropriate buffered solutions.

       

      Shipping and Storage

      The products are shipped with ice pack and can be stored at -20℃ to -80℃ for 1 year.
      Recommend to aliquot the protein into smaller quantities when first used and avoid repeated freeze-thaw cycles.

       

      Cautions

      1. Avoid repeated freeze-thaw cycles.
      2. For your safety and health, please wear lab coats and disposable gloves for operation.
      3. For research use only.

      © 2025 Arcegen, Powered by Shopify

      • American Express
      • Apple Pay
      • Diners Club
      • Discover
      • Google Pay
      • Mastercard
      • Shop Pay
      • Visa

      Login

      Forgot your password?

      Don't have an account yet?
      Create account